Hcst (BC069220) Mouse Tagged ORF Clone
CAT#: MR200079
- TrueORF®
Hcst (Myc-DDK-tagged) - Mouse hematopoietic cell signal transducer (cDNA clone MGC:73601 IMAGE:640698)
ORF Plasmid: tGFP
"BC069220" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1800.00
| Cited in 3 publications. |
CNY 300.00
CNY 6840.00
Specifications
| Product Data | |
| Type | Mouse Tagged ORF Clone |
| Tag | Myc-DDK |
| Synonyms | DAP10, KAP10 |
| Vector | pCMV6-Entry |
| E. coli Selection | Kanamycin (25 ug/mL) |
| Mammalian Cell Selection | Neomycin |
| Sequence Data |
>MR200079 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGACCCCCCAGGCTACCTCCTGTTCCTGCTTCTGCTCCCAGGTTCCTGCTCCGGATGTGGGACTCTGT CTCTGCCACTCCTGGCAGGCCTAGTGGCTGCAGATGCGGTCATGTCACTCCTAATTGTAGGGGTGGTGTT TGTATGTATGCGCCCACACGGCAGGCCTGCCCAAGAAGATGGTAGAGTCTACATCAACATGCCTGGCAGA GGC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200079 protein sequence
Red=Cloning site Green=Tags(s) MDPPGYLLFLLLLPGSCSGCGTLSLPLLAGLVAADAVMSLLIVGVVFVCMRPHGRPAQEDGRVYINMPGR G myc-FLAG tag |
| Restriction Sites | SgfI-MluI Cloning Scheme for this gene |
| ACCN | BC069220 |
| ORF Size | 213 bp |
| OTI Disclaimer | Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery. The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
| OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
| Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
| Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
| Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
| Reference Data | |
| RefSeq | BC069220, AAH69220 |
| RefSeq Size | 487 bp |
| RefSeq ORF | 215 bp |
| Locus ID | 23900 |
| MW | 7.4 kDa |
| Gene Summary | Transmembrane adapter protein which associates with KLRK1 to form an activation receptor KLRK1-HCST in lymphoid and myeloid cells; this receptor plays a major role in triggering cytotoxicity against target cells expressing cell surface ligands such as MHC class I chain-related MICA and MICB, and UL16-binding proteins (ULBPs); these ligands are up-regulated by stress conditions and pathological state such as viral infection and tumor transformation. Functions as docking site for PI3-kinase PIK3R1 and GRB2. Interaction of ULBPs with KLRK1-HCST triggers calcium mobilization and activation of the PIK3R1, MAP2K/ERK, and JAK2/STAT5 signaling pathways. Both PIK3R1 and GRB2 are required for full KLRK1-HCST-mediated activation and ultimate killing of target cells. In NK cells, KLRK1-HCST signaling directly induces cytotoxicity and enhances cytokine production initiated via DAP12/TYROBP-associated receptors. In T-cells, it provides primarily costimulation for TCR-induced signals. KLRK1-HCST receptor plays a role in immune surveillance against tumors and is required for cytolysis of tumors cells; indeed, melanoma cells that do not express KLRK1 ligands escape from immune surveillance mediated by NK cells.[UniProtKB/Swiss-Prot Function] |
Citations (3)
| The use of this cDNA Clones has been cited in the following citations: |
|---|
|
T cells expressing a chimeric-PD1-Dap10-CD3zeta receptor reduce tumor burden in multiple murine syngeneic models of solid cancer
,Parriott, G;Deal, K;Crean, S;Richardson, E;Nylen, E;Barber, A;,
Immunology
,PubMed ID 32144940
[HCST]
|
|
Inclusion of Dap10 or 4-1BB costimulation domains in the chPD1 receptor enhances anti-tumor efficacy of T cells in murine models of lymphoma and melanoma
,Kintz, H;Nylen, E;Barber, A;,
Cell. Immunol.
,PubMed ID 32106933
[HCST]
|
|
Adoptive transfer of murine T cells expressing a chimeric-PD1-Dap10 receptor as an immunotherapy for lymphoma
,Lynch, A;Hawk, W;Nylen, E;Ober, S;Autin, P;Barber, A;,
Immunology
,PubMed ID 28670716
[HCST]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| MC206863 | Hcst (untagged) - Mouse hematopoietic cell signal transducer (cDNA clone MGC:73601 IMAGE:640698), (10ug) |
CNY 1800.00 |
|
| MG200079 | Hcst (tGFP-tagged) - Mouse hematopoietic cell signal transducer (cDNA clone MGC:73601 IMAGE:640698) |
CNY 4370.00 |
|
| MR200079L3 | Lenti ORF clone of Hcst (Myc-DDK-tagged) - Mouse hematopoietic cell signal transducer (cDNA clone MGC:73601 IMAGE:640698) |
CNY 5890.00 |
|
| MR200079L4 | Lenti ORF clone of Hcst (mGFP-tagged) - Mouse hematopoietic cell signal transducer (cDNA clone MGC:73601 IMAGE:640698) |
CNY 5890.00 |
