Oaz1 (BC094287) Mouse Tagged ORF Clone
CAT#: MR200056
- TrueORF®
Oaz1 (Myc-DDK-tagged) - Mouse ornithine decarboxylase antizyme (cDNA clone MGC:106390 IMAGE:5257966)
ORF Plasmid: tGFP
"BC094287" in other vectors (4)
Need custom modification / cloning service?
Get a free quote
CNY 1200.00
CNY 2945.00
CNY 6840.00
Specifications
Product Data | |
Type | Mouse Tagged ORF Clone |
Tag | Myc-DDK |
Synonyms | ODC-Az, Oaz, AZ-1, Antizyme |
Vector | pCMV6-Entry |
E. coli Selection | Kanamycin (25 ug/mL) |
Mammalian Cell Selection | Neomycin |
Sequence Data |
>MR200056 ORF sequence
Red=Cloning site Blue=ORF Green=Tags(s) TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC GCCGCGATCGCC ATGGTGAAATCCTCCCTGCAGCGGATCCTCAACAGCCACTGCTTCGCCAGAGAGAAGGAAGGGGACAAAC GCAGCGCCACGCTTCACGCCAGCCGCACCATGCCGCTTCTTAGTCAGCACAGCCGCGGCGGCTGCAGCAG CGAGAGGGTTGCCCTTAATTGCTGTAGTAACCTGGGTCCGGGGCCTCGGTGGTGCTCC ACGCGTACGCGGCCGCTCGAGCAGAAACTCATCTCAGAAGAGGATCTGGCAGCAAATGATATCCTGGATT ACAAGGATGACGACGATAAGGTTTAA >MR200056 protein sequence
Red=Cloning site Green=Tags(s) MVKSSLQRILNSHCFAREKEGDKRSATLHASRTMPLLSQHSRGGCSSERVALNCCSNLGPGPRWCS myc-FLAG tag |
Restriction Sites |
SgfI-MluI
Cloning Scheme for this gene
Plasmid Map
![]() |
ACCN | BC094287 |
ORF Size | 198 bp |
OTI Disclaimer | The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info |
OTI Annotation | This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene. |
Product Components | The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water). |
Reconstitution | 1. Centrifuge at 5,000xg for 5min. 2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA. 3. Close the tube and incubate for 10 minutes at room temperature. 4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom. 5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C. |
Note | Plasmids are not sterile. For experiments where strict sterility is required, filtration with 0.22um filter is required. |
Reference Data | |
RefSeq | BC094287, AAH94287 |
RefSeq Size | 1022 bp |
RefSeq ORF | 200 bp |
Locus ID | 18245 |
MW | 7.2 kDa |
Gene Summary | The protein encoded by this gene belongs to the ornithine decarboxylase antizyme family, which plays a role in cell growth and proliferation by regulating intracellular polyamine levels. Expression of antizymes requires +1 ribosomal frameshifting, which is enhanced by high levels of polyamines. Antizymes in turn bind to and inhibit ornithine decarboxylase (ODC), the key enzyme in polyamine biosynthesis; thus, completing the auto-regulatory circuit. This gene encodes antizyme 1, the first member of the antizyme family, that has broad tissue distribution, and negatively regulates intracellular polyamine levels by binding to and targeting ODC for degradation, as well as inhibiting polyamine uptake. Antizyme 1 mRNA contains two potential in-frame AUGs; and studies in rat suggest that alternative use of the two translation initiation sites results in N-terminally distinct protein isoforms with different subcellular localization. Alternatively spliced transcript variants have also been noted for this gene. [provided by RefSeq, Dec 2014] |
Documents
Product Manuals |
FAQs |
SDS |
Resources
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
MC206846 | Oaz1 (untagged) - Mouse ornithine decarboxylase antizyme (cDNA clone MGC:106390 IMAGE:5257966), (10ug) |
CNY 3230.00 |
|
MG200056 | Oaz1 (tGFP-tagged) - Mouse ornithine decarboxylase antizyme (cDNA clone MGC:106390 IMAGE:5257966) |
CNY 2850.00 |
|
MR200056L3 | Lenti ORF clone of Oaz1 (Myc-DDK-tagged) - Mouse ornithine decarboxylase antizyme (cDNA clone MGC:106390 IMAGE:5257966) |
CNY 4750.00 |
|
MR200056L4 | Lenti ORF clone of Oaz1 (mGFP-tagged) - Mouse ornithine decarboxylase antizyme (cDNA clone MGC:106390 IMAGE:5257966) |
CNY 4750.00 |