Nr1h4 (BC015261) Mouse Tagged ORF Clone

CAT#: MG207746

  • TrueORF®

Nr1h4 (tGFP-tagged) - Mouse nuclear receptor subfamily 1, group H, member 4 (cDNA clone MGC:18424 IMAGE:4241705)



Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 4750.00


货期*
4周

规格
    • 10 ug

Product images

推荐一起购买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms HRR1, RIP14
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG207746 representing BC015261
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGTGATGCAGTTTCAGGGTTTAGAAAATCCAATTCAGATTAGTCTTCACCACAGCCACCGGCTGTCAG
GATTTGTGCCGGACGGGATGAGTGTGAAGCCAGCTAAAGGTATGCTAACAGAACACGCGGCAGGCCCTCT
GGGGCAGAATCTGGATTTGGAATCGTACTCCCCATACAACAATGTCCCGTTTCCTCAAGTTCAGCCACAG
ATTTCCTCCTCGTCTTACTATTCCAACCTGGGCTTCTACCCCCAACAACCGGAAGACTGGTATTCTCCTG
GCATCTATGAACTCAGGCGAATGCCCGCTGAGACTGGGTACCAGGGAGAGACTGAGGTATCAGAGATGCC
TGTGACAAAGAAGCCGCGAATGGCCGCGGCATCGGCAGGCAGAATAAAAGGGGATGAGCTGTGTGTTGTC
TGTGGAGACAGGGCCTCTGGGTACCACTACAACGCGCTCACCTGTGAGGGCTGCAAAGGTTTCTTCCGAA
GAAGCATTACCAAGAACGCCGTGTACAAGTGTAAGAACGGGGGCAACTGCGTGATGGACATGTACATGCG
CAGGAAGTGCCAGGAGTGCCGGCTAAGGAAGTGCAGAGAGATGGGGATGTTGGCTGAATGTTTGTTAACT
GAAATCCAGTGTAAATCTAAACGGCTAAGGAAAAATGTGAAGCAGCACGCTGATCAGACAGTGAATGAGG
ACGACAGCGAAGGGCGTGACTTGCGACAAGTGACCTCCACAACCAAGTTTTGCAGGGAGAAAACGGAACT
CACGGCAGACCAGCAGACCCTCCTGGATTATATTATGGATTCGTACAACAAACAGAGAATGCCTCAGGAA
ATCACAAATAAAATCTTAAAAGAAGAATTTAGTGCAGAAGAAAATTTTCTCATATTAACAGAAATGGCAA
CCAGTCATGTACAGATTCTCGTAGAATTCACAAAAAAGCTTCCAGGGTTTCAGACACTGGACCACGAAGA
TCAGATTGCTTTGCTCAAAGGGTCCGCAGTGGAGGCCATGTTTCTTCGTTCGGCGGAGATTTTCAATAAG
AAACTTCCTGCCGGACATGCAGACCTGTTGGAAGAAAGAATTCGAAAGAGTGGTATCTCTGATGAGTATA
TAACCCCGATGTTCAGTTTCTATAAAAGTGTTGGAGAACTCAAAATGACTCAGGAGGAGTACGCTCTGCT
CACAGCGATCGTCATCCTCTCTCCAGACAGACAATACATCAAGGACAGAGAGGCGGTGGAGAAGCTGCAG
GAGCCCCTGCTTGATGTGCTACAAAAGCTGTGCAAGATGTACCAGCCTGAGAACCCACAGCATTTCGCCT
GCCTCCTGGGTCGCCTGACGGAACTCCGGACATTCAACCATCACCACGCTGAGATGCTGATGTCTTGGAG
AGTGAATGATCACAAGTTCACCCCGCTCCTCTGTGAGATCTGGGATGTGCAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG207746 representing BC015261
Red=Cloning site Green=Tags(s)

MVMQFQGLENPIQISLHHSHRLSGFVPDGMSVKPAKGMLTEHAAGPLGQNLDLESYSPYNNVPFPQVQPQ
ISSSSYYSNLGFYPQQPEDWYSPGIYELRRMPAETGYQGETEVSEMPVTKKPRMAAASAGRIKGDELCVV
CGDRASGYHYNALTCEGCKGFFRRSITKNAVYKCKNGGNCVMDMYMRRKCQECRLRKCREMGMLAECLLT
EIQCKSKRLRKNVKQHADQTVNEDDSEGRDLRQVTSTTKFCREKTELTADQQTLLDYIMDSYNKQRMPQE
ITNKILKEEFSAEENFLILTEMATSHVQILVEFTKKLPGFQTLDHEDQIALLKGSAVEAMFLRSAEIFNK
KLPAGHADLLEERIRKSGISDEYITPMFSFYKSVGELKMTQEEYALLTAIVILSPDRQYIKDREAVEKLQ
EPLLDVLQKLCKMYQPENPQHFACLLGRLTELRTFNHHHAEMLMSWRVNDHKFTPLLCEIWDVQ

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC015261
ORF Size 1452 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC015261, AAH15261
RefSeq Size 1717 bp
RefSeq ORF 1454 bp
Locus ID 20186
Gene Summary Ligand-activated transcription factor. Receptor for bile acids (BAs) such as chenodeoxycholic acid (CDCA), lithocholic acid, deoxycholic acid (DCA) and allocholic acid (ACA). Plays a essential role in BA homeostasis through the regulation of genes involved in BA synthesis, conjugation and enterohepatic circulation. Also regulates lipid and glucose homeostasis and is involved in innate immune response (PubMed:11030617, PubMed:21383957, PubMed:22820415). The FXR-RXR heterodimer binds predominantly to farnesoid X receptor response elements (FXREs) containing two inverted repeats of the consensus sequence 5'-AGGTCA-3' in which the monomers are spaced by 1 nucleotide (IR-1) but also to tandem repeat DR1 sites with lower affinity, and can be activated by either FXR or RXR-specific ligands. It is proposed that monomeric nuclear receptors such as NR5A2/LRH-1 bound to coregulatory nuclear responsive element (NRE) halfsites located in close proximity to FXREs modulate transcriptional activity (PubMed:20091679, PubMed:20483916). In the liver activates transcription of the corepressor NR0B2 thereby indirectly inhibiting CYP7A1 and CYP8B1 (involved in BA synthesis) implicating at least in part histone demethylase KDM1A resulting in epigenomic repression, and SLC10A1/NTCP (involved in hepatic uptake of conjugated BAs). Activates transcription of the repressor MAFG (involved in regulation of BA synthesis) (PubMed:21383957, PubMed:25651182, PubMed:25545350). Activates transcription of SLC27A5/BACS and BAAT (involved in BA conjugation), ABCB11/BSEP (involved in bile salt export) by directly recruiting histone methyltransferase CARM1, and ABCC2/MRP2 (involved in secretion of conjugated BAs) and ABCB4 (involved in secretion of phosphatidylcholine in the small intestine) (PubMed:21383957). In ileal enterocytes activates FABP6/IBABP (involved in cytosolic transport), SLC51A/OSTA and SLC51B/OSTB (involved in secretion of conjugated BAs to the portal blood), and repressor NR0B2/SHP thereby indirectly inhibiting SLC10A2/ASBT (involved in BA uptake) (By similarity). In the intestine activates FGF15 expression and secretion leading to hepatic CYP7A1 repression; the function also involves the coordinated induction of hepatic KLB/beta-klotho expression (PubMed:16213224, PubMed:26505219). Transcriptional activation of FABP6/IBAP and SCD1 but not of ABCB11 is isoform-specific (PubMed:12393883). Regulates transcription of liver UGT2B4 and SULT2A1 involved in BA detoxification; binding to the UGT2B4 promoter seems to imply a monomeric transactivation independent of RXRA (By similarity). Modulates lipid homeostasis by activating liver NR0B2/SHP-mediated repression of SREBF1 isoform SREBP-1C (involved in de novo lipogenesis), expression of PLTP (involved in HDL formation), SCARB1 (involved in HDL hepatic uptake), APOE, APOC1, APOC4, VLDLR and SDC1 (involved in the hepatic uptake of LDL and IDL remnants), and inhibiting expression of MTTP (involved in VLDL assembly) (PubMed:12421815, PubMed:15146238). Increases expression of APOC2 (promoting lipoprotein lipase activity implicated in triglyceride clearance) (PubMed:11579204). Transrepresses APOA1 probably involving a monomeric competition with NR2A1 for binding to a DR1 element (PubMed:21804189). Also reduces triglyceride clearance by inhibiting expression of ANGPTL3 and APOC3 (both involved in inhibition of lipoprotein lipase) (PubMed:12891557, PubMed:15146238). Involved in glucose homeostasis by modulating hepatic gluconeogenesis through activation of NR0B2/SHP-mediated repression of respective genes. Modulates glycogen synthesis (inducing phosphorylation of glycogen synthase kinase-3). Modulates glucose-stimulated insulin secretion and is involved in insulin resistance (PubMed:15564327, PubMed:16446356, PubMed:16557297, PubMed:16410358, PubMed:20447400). Involved in intestinal innate immunity. Plays a role in protecting the distal small intestine against bacterial overgrowth and preservation of the epithelial barrier (PubMed:16473946, PubMed:21242261). Down-
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...