Snai1 (NM_011427) Mouse Tagged ORF Clone

CAT#: MG203505

  • TrueORF®

Snai1 (tGFP-tagged) - Mouse snail homolog 1 (Drosophila) (Snai1)

ORF Plasmid: DDK tGFP



  "NM_011427" in other vectors (6)

Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 5,200.00


货期*
现货

规格
    • 10 ug

Product images

经常一起买 (3)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6,080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1,000.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms Sna; Sna1; Snail; Snail1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG203505 representing NM_011427
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGCCGCGCTCCTTCCTGGTCAGGAAGCCGTCCGACCCCCGCCGGAAGCCCAACTATAGCGAGCTGCAGG
ACGCGTGTGTGGAGTTCACCTTCCAGCAGCCCTACGACCAGGCCCACCTGCTGGCCGCCATCCCTCCGCC
CGAGGTCCTCAACCCCGCCGCTTCGCTGCCCACCCTCATCTGGGACTCTCTCCTGGTACCCCAAGTGCGG
CCGGTTGCCTGGGCCACCCTCCCGCTGCGGGAGAGCCCCAAGGCCGTAGAGCTGACCTCGCTGTCCGATG
AGGACAGTGGCAAAAGCTCCCAGCCGCCCAGCCCGCCCTCGCCGGCGCCGTCGTCCTTCTCGTCCACCTC
GGCCTCGTCCCTGGAGGCCGAGGCCTTCATCGCCTTCCCTGGCTTGGGCCAACTTCCCAAGCAGCTGGCC
AGGCTCTCGGTGGCCAAGGACCCCCAGTCGCGGAAGATCTTCAACTGCAAATATTGTAACAAGGAGTACC
TCAGCCTGGGCGCTCTGAAGATGCACATCCGAAGCCACACGCTGCCTTGTGTCTGCACGACCTGTGGAAA
GGCCTTCTCTAGGCCCTGGCTGCTTCAGGGCCACGTCCGCACCCACACTGGTGAGAAGCCATTCTCCTGC
TCCCACTGCAACCGTGCTTTTGCTGACCGCTCCAACCTGCGTGCCCACCTCCAAACCCACTCGGATGTGA
AGAGATACCAGTGCCAGGCCTGTGCCCGAACCTTCTCCCGCATGTCCTTGCTCCACAAGCACCAAGAGTC
TGGCTGCTCCGGAGGCCCTCGC


AGCGGACCGACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG203505 representing NM_011427
Red=Cloning site Green=Tags(s)

MPRSFLVRKPSDPRRKPNYSELQDACVEFTFQQPYDQAHLLAAIPPPEVLNPAASLPTLIWDSLLVPQVR
PVAWATLPLRESPKAVELTSLSDEDSGKSSQPPSPPSPAPSSFSSTSASSLEAEAFIAFPGLGQLPKQLA
RLSVAKDPQSRKIFNCKYCNKEYLSLGALKMHIRSHTLPCVCTTCGKAFSRPWLLQGHVRTHTGEKPFSC
SHCNRAFADRSNLRAHLQTHSDVKRYQCQACARTFSRMSLLHKHQESGCSGGPR

SGPTRTRRLE - GFP Tag - V
Restriction Sites SgfI-RsrII      Cloning Scheme for this gene      Plasmid Map     
ACCN NM_011427
ORF Size 792 bp
OTI Disclaimer Due to the inherent nature of this plasmid, standard methods to replicate additional amounts of DNA in E. coli are highly likely to result in mutations and/or rearrangements. Therefore, OriGene does not guarantee the capability to replicate this plasmid DNA. Additional amounts of DNA can be purchased from OriGene with batch-specific, full-sequence verification at a reduced cost. Please contact our customer care team at custsupport@origene.com or by calling 301.340.3188 option 3 for pricing and delivery.

The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Reference Data
RefSeq NM_011427.2, NP_035557.1
RefSeq Size 1613 bp
RefSeq ORF 795 bp
Locus ID 20613
UniProt ID Q02085
Gene Summary Involved in induction of the epithelial to mesenchymal transition (EMT), formation and maintenance of embryonic mesoderm, growth arrest, survival and cell migration. Binds to 3 E-boxes of the E-cadherin gene promoter and to the promoters of CLDN7 and KRT8 and, in association with histone demethylase KDM1A which it recruits to the promoters, causes a decrease in dimethylated H3K4 levels and represses transcription. Involved in induction of the epithelial to mesenchymal transition (EMT), formation and maintenance of embryonic mesoderm, growth arrest, survival and cell migration. Binds to 3 E-boxes of the E-cadherin/CDH1 gene promoter and to the promoters of CLDN7 and KRT8 and, in association with histone demethylase KDM1A which it recruits to the promoters, causes a decrease in dimethylated H3K4 levels and represses transcription. The N-terminal SNAG domain competes with histone H3 for the same binding site on the histone demethylase complex formed by KDM1A and RCOR1, and thereby inhibits demethylation of histone H3 at 'Lys-4' (in vitro) (By similarity). During EMT, involved with LOXL2 in negatively regulating pericentromeric heterochromatin transcription (PubMed:24239292). SNAI1 recruits LOXL2 to pericentromeric regions to oxidize histone H3 and repress transcription which leads to release of heterochromatin component CBX5/HP1A, enabling chromatin reorganization and acquisition of mesenchymal traits (PubMed:24239292). Associates with EGR1 and SP1 to mediate 12-O-tetradecanoylphorbol-13-acetate (TPA)-induced up-regulation of CDKN2B, possibly by binding to the CDKN2B promoter region 5'-TCACA-3'. In addition, may also activate the CDKN2B promoter by itself.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Other Versions

Customer Reviews 
Loading...