Homer1 (BC064041) Mouse Tagged ORF Clone

CAT#: MG201745

  • TrueORF®

Homer1 (tGFP-tagged) - Mouse homer homolog 1 (Drosophila) (cDNA clone MGC:73537 IMAGE:1398649)



Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2850.00


货期*
4周

规格
    • 10 ug

Product images

推荐一起购买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms homer-1; PSD-Zip45; SYN47; Ves-1; vesl-1
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG201745 representing BC064041
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGGGGGAGCAACCTATCTTCAGCACTCGAGCTCATGTCTTCCAGATTGACCCGAACACAAAGAAGAACT
GGGTACCCACCAGCAAGCATGCAGTTACTGTATCTTATTTTTATGACAGCACAAGAAATGTGTATAGGAT
AATCAGTTTAGATGGCTCAAAGGCAATAATAAATAGCACCATCACACCAAACATGACATTTACTAAAACA
TCTCAAAAGTTTGGCCAATGGGCTGATAGCCGGGCAAACACTGTTTATGGACTGGGATTCTCCTCTGAGC
ATCATCTTTCAAAATTCGCAGAAAAGTTTCAGGAATTTAAGGAAGCTGCTCGGCTTGCAAAGGAGAAGTC
GCAGGAGAAGATGGAGCTGACCAGTACCCCTTCACAGGAATCAGCAGGAGGAGATCTTCAGTCTCCTTTG
ACACCAGAAAGTATCAATGGGACAGACGATGAGAGAACACCCGATGTGACACAGAACTCAGAGCCAAGGG
CTGAGCCAACTCAGAATGCATTGCCATTTCCACATAGGTACACATTCAATTCAGCAATCATGATTAAG


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG201745 representing BC064041
Red=Cloning site Green=Tags(s)

MGEQPIFSTRAHVFQIDPNTKKNWVPTSKHAVTVSYFYDSTRNVYRIISLDGSKAIINSTITPNMTFTKT
SQKFGQWADSRANTVYGLGFSSEHHLSKFAEKFQEFKEAARLAKEKSQEKMELTSTPSQESAGGDLQSPL
TPESINGTDDERTPDVTQNSEPRAEPTQNALPFPHRYTFNSAIMIK

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC064041
ORF Size 558 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC064041, AAH64041
RefSeq Size 1922 bp
RefSeq ORF 560 bp
Locus ID 26556
Gene Summary Postsynaptic density scaffolding protein. Binds and cross-links cytoplasmic regions of GRM1, GRM5, ITPR1, DNM3, RYR1, RYR2, SHANK1 and SHANK3. By physically linking GRM1 and GRM5 with ER-associated ITPR1 receptors, it aids the coupling of surface receptors to intracellular calcium release. May also couple GRM1 to PI3 kinase through its interaction with AGAP2. Isoform 1 regulates the trafficking and surface expression of GRM5. Differentially regulates the functions of the calcium activated channel ryanodine receptors RYR1 and RYR2. Isoform 1 decreases the activity of RYR2, and increases the activity of RYR1, whereas isoform 5 counteracts the effects by competing for binding sites. Isoform 3 regulates the trafficking and surface expression of GRM5. Isoform 5 acts as a natural dominant negative, in dynamic competition with constitutively expressed isoform 1, isoform 2 and isoform 3 to regulate synaptic metabotropic glutamate function. Isoform 5, may be involved in the structural changes that occur at synapses during long-lasting neuronal plasticity and development (By similarity). Forms a high-order complex with SHANK1, which in turn is necessary for the structural and functional integrity of dendritic spines (By similarity). Negatively regulates T cell activation by inhibiting the calcineurin-NFAT pathway. Acts by competing with calcineurin/PPP3CA for NFAT protein binding, hence preventing NFAT activation by PPP3CA (By similarity).[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...