Pde6d (BC005636) Mouse Tagged ORF Clone

CAT#: MG201058

  • TrueORF®

Pde6d (tGFP-tagged) - Mouse phosphodiesterase 6D, cGMP-specific, rod, delta (cDNA clone MGC:11435 IMAGE:3964336)



Need custom modification / cloning service?
Get a free quote

Mouse Protein / Lysate Request

CNY 2850.00


货期*
4周

规格
    • 10 ug

Product images

推荐一起购买 (4)
pCMV6-AC-GFP, mammalian vector with C-terminal tGFP tag, 10ug
    • 10 ug

CNY 6080.00


Mouse monoclonal turboGFP antibody, clone OTI2H8
    • 100 ul

CNY 1000.00


DH5α Chemically Competent Cells (≥10^8 cfu/μg of pUC19 DNA)
    • 5 x 200 ul

CNY 1280.00


Forward sequencing primer VP1.5, Reverse sequencing primer XL39, 100pmoles each
    • 100 pmol

CNY 480.00

Specifications

Product Data
Type Mouse Tagged ORF Clone
Tag TurboGFP
Synonyms AI841218; PrBP/delta
Vector pCMV6-AC-GFP
E. coli Selection Ampicillin (100 ug/mL)
Mammalian Cell Selection Neomycin
Sequence Data
>MG201058 representing BC005636
Red=Cloning site Blue=ORF Green=Tags(s)

TTTTGTAATACGACTCACTATAGGGCGGCCGGGAATTCGTCGACTGGATCCGGTACCGAGGAGATCTGCC
GCCGCGATCGCC

ATGTCAGCCAAGGACGAGCGGGCCAGGGATATCCTGAGAGGCTTCAAACTAAATTGGATGAACCTTCGGG
ATGCCGAAACAGGGAAGATACTCTGGCAAGGAACAGAAGACCTGTCTGTCCCTGGTGTGGAACATGAAGC
CCGTGTGCCCAAGAAAATCCTCAAGTGCAAGGCAGTGTCTCGAGAATTGAACTTTTCTTCAGCAGAACAA
ATGGAAAAATTCCGCCTGGAACAAAAAGTTTACTTCAAAGGACAATGCCTAGAAGAGTGGTTCTTCGAGT
TTGGCTTTGTGATCCCTAACTCCACAAACACCTGGCAGTCCTTGATAGAAGCAGCGCCTGAGTCCCAGAT
GATGCCCGCCAGCGTCCTAACGGGCAATGTCATCATAGAGACAAAGTTCTTTGACGATGATCTTCTTGTC
AGCACATCCAAAGTGAGGCTTTTCTATGTT


ACGCGTACGCGGCCGCTCGAG - GFP Tag - GTTTAA
>MG201058 representing BC005636
Red=Cloning site Green=Tags(s)

MSAKDERARDILRGFKLNWMNLRDAETGKILWQGTEDLSVPGVEHEARVPKKILKCKAVSRELNFSSAEQ
MEKFRLEQKVYFKGQCLEEWFFEFGFVIPNSTNTWQSLIEAAPESQMMPASVLTGNVIIETKFFDDDLLV
STSKVRLFYV

TRTRPLE - GFP Tag - V
Restriction Sites SgfI-MluI      Cloning Scheme for this gene      Plasmid Map     
ACCN BC005636
ORF Size 450 bp
OTI Disclaimer The molecular sequence of this clone aligns with the gene accession number as a point of reference only. However, individual transcript sequences of the same gene can differ through naturally occurring variations (e.g. polymorphisms), each with its own valid existence. This clone is substantially in agreement with the reference, but a complete review of all prevailing variants is recommended prior to use. More info
OTI Annotation This clone was engineered to express the complete ORF with an expression tag. Expression varies depending on the nature of the gene.
Product Components The ORF clone is ion-exchange column purified and shipped in a 2D barcoded Matrix tube containing 10ug of transfection-ready, dried plasmid DNA (reconstitute with 100 ul of water).
Reconstitution 1. Centrifuge at 5,000xg for 5min.
2. Carefully open the tube and add 100ul of sterile water to dissolve the DNA.
3. Close the tube and incubate for 10 minutes at room temperature.
4. Briefly vortex the tube and then do a quick spin (less than 5000xg) to concentrate the liquid at the bottom.
5. Store the suspended plasmid at -20°C. The DNA is stable for at least one year from date of shipping when stored at -20°C.
Note Plasmids are not sterile.  For experiments where strict sterility is required, filtration with 0.22um filter is required.
Reference Data
RefSeq BC005636, AAH05636
RefSeq Size 1109 bp
RefSeq ORF 452 bp
Locus ID 18582
Gene Summary Promotes the release of prenylated target proteins from cellular membranes (PubMed:22179043). Modulates the activity of prenylated or palmitoylated Ras family members by regulating their subcellular location (PubMed:22179043). Required for normal ciliary targeting of farnesylated target proteins, such as INPP5E (By similarity). Modulates the subcellular location of target proteins by acting as a GTP specific dissociation inhibitor (GDI) (PubMed:22179043). Increases the affinity of ARL3 for GTP by several orders of magnitude. Stabilizes ARL3-GTP by decreasing the nucleotide dissociation rate.[UniProtKB/Swiss-Prot Function]
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...