AICDA Rabbit Polyclonal Antibody
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence VKRRDSATSFSLDFGYLRNKNGCHVELLFLRYISDWDLDPGRCYRVTWFT |
Specificity | Expected reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat Homology: Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Predicted Protein Size | 24 kDa |
Gene Name | activation-induced cytidine deaminase |
Database Link | |
Background | This gene encodes a RNA-editing deaminase that is a member of the cytidine deaminase family. The protein is involved in somatic hypermutation, gene conversion, and class-switch recombination of immunoglobulin genes. Defects in this gene are the cause of autosomal recessive hyper-IgM immunodeficiency syndrome type 2 (HIGM2). |
Synonyms | AID; ARP2; CDA2; HIGM2 |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Primary immunodeficiency |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |