GNRH2 Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 9998.00
CNY 3080.00
Specifications
Product Data | |
Applications | IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen is a synthetic peptide directed towards the following sequence SDALAPLDDSMPWEGRTTAQWSLHRKRHLARTLLTAAREPRPAPPSSNKV |
Specificity | Expected reactivity: Human Homology: Human: 100% |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Concentration | lot specific |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | For short term use, store at 2-8°C up to 1 week. For long term storage, store at -20°C in small aliquots to prevent freeze-thaw cycles. |
Predicted Protein Size | 13 kDa |
Gene Name | gonadotropin releasing hormone 2 |
Database Link | |
Background | The protein encoded by this gene is a preproprotein that is cleaved to form a secreted 10 aa peptide hormone. The secreted decapeptide regulates reproduction in females by stimulating the secretion of both luteinizing- and follicle-stimulating hormones. Three transcript variants that encode unique proproteins but the same peptide hormone have been found for this gene. |
Synonyms | GnRH-II; LH-RHII; OTTHUMP00000030076; OTTHUMP00000030077 |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | GnRH signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |