Transglutaminase 7 (TGM7) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TGM7 antibody: synthetic peptide directed towards the C terminal of human TGM7. Synthetic peptide located within the following region: TQKPFWRHTVRMNLDFGKETQWPLLLPYSNYRNKLTDEKLIRVSGIAEVE
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	80 kDa
Gene Name	transglutaminase 7
Database Link	NP_443187 Entrez Gene 116179 Human UniProt ID Q96PF1
Background	Transglutaminases (TGM; EC 2.3.2.13) are a family of structurally and functionally related enzymes that stabilize protein assemblies through the formation of gamma-glutamyl-epsilon lysine crosslinks. For additional background information on transglutaminases, see TGM1 (MIM 190195). [supplied by OMIM, Jul 2002]. ##Evidence-Data-START## Transcript exon combination :: AF363393.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025087, ERS025093 [ECO:0000350] ##Evidence-Data-END##
Synonyms	TGMZ
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Bovine: 93%; Rabbit: 93%; Rat: 92%; Guinea pig: 86%; Mouse: 85%; Horse: 79%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.