PGS1 Rabbit Polyclonal Antibody
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PGS1 antibody: synthetic peptide directed towards the C terminal of human PGS1. Synthetic peptide located within the following region: QIAIVTENQALQQQLHQEQEQLYLRSGVVSSATFEQPSRQVKLWVKMVTP |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 63 kDa |
Gene Name | phosphatidylglycerophosphate synthase 1 |
Database Link | |
Background | Functions in the biosynthesis of the anionic phospholipids phosphatidylglycerol and cardiolipin. |
Synonyms | DKFZp762M186; MGC131960 |
Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rat: 93%; Horse: 93%; Mouse: 86% |
Reference Data | |
Protein Pathways | Glycerophospholipid metabolism, Metabolic pathways |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |