DNMT3A Rabbit Polyclonal Antibody

CAT#: TA346818

Rabbit Polyclonal Anti-DNMT3A Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Cited in 1 publication.

Product images

推荐一起购买 (4)
Transient overexpression lysate of DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human DNA (cytosine-5-)-methyltransferase 3 alpha (DNMT3A), transcript variant 3, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Mouse, Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for Anti-DNMT3A antibody is: synthetic peptide directed towards the C-terminal region of Human DNMT3A. Synthetic peptide located within the following region: STVNDKLELQECLEHGRIAKFSKVRTITTRSNSIKQGKDQHFPVFMNEKE
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 38 kDa
Gene Name DNA (cytosine-5-)-methyltransferase 3 alpha
Background CpG methylation is an epigenetic modification that is important for embryonic development, imprinting, and X-chromosome inactivation. Studies in mice have demonstrated that DNA methylation is required for mammalian development. This gene encodes a DNA methyltransferase that is thought to function in de novo methylation, rather than maintenance methylation. The protein localizes to the cytoplasm and nucleus and its expression is developmentally regulated. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008]
Synonyms DNMT3A2; M.HsaIIIA; TBRS
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100%
Reference Data
Protein Families Druggable Genome
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Citations (1)

Customer Reviews 
Loading...