ECHDC1 Rabbit Polyclonal Antibody
CAT#: TA346800
Rabbit Polyclonal Anti-ECHDC1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ECHDC1 antibody: synthetic peptide directed towards the middle region of human ECHDC1. Synthetic peptide located within the following region: GVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAVKSLGTPEDG |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 33 kDa |
Gene Name | ethylmalonyl-CoA decarboxylase 1 |
Database Link | |
Background | ECHDC1 belongs to the enoyl-CoA hydratase/isomerase family. The exact function of ECHDC1 remains unknown. |
Synonyms | dJ351K20.2; HEL-S-76; MMCD |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Horse: 93%; Rabbit: 93%; Mouse: 92% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |