NUDT13 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NUDT13 antibody: synthetic peptide directed towards the N terminal of human NUDT13. Synthetic peptide located within the following region: MSLYCGIACRRKFFWCYRLLSTYVTKTRYLFELKEDDDACKKAQQTGAFY
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	nudix hydrolase 13
Database Link	NP_056985 Entrez Gene 25961 Human UniProt ID Q86X67
Background	NUDT13 contains 1 nudix hydrolase domain. The exact function of NUDT13 remains unknown.
Synonyms	nudix (nucleoside diphosphate linked moiety X)-type motif 13; nudix-type motif 13; OTTHUMP00000019799
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Guinea pig: 100%; Rat: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.