MEKK1 (MAP3K1) Rabbit Polyclonal Antibody
CAT#: TA346746
Rabbit Polyclonal Anti-MAP3K1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MAP3K1 antibody: synthetic peptide directed towards the C terminal of human MAP3K1. Synthetic peptide located within the following region: LGAFSSCYQAQDVGTGTLMAVKQVTYVRNTSSEQEEVVEALREEIRMMSH |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 164 kDa |
Gene Name | mitogen-activated protein kinase kinase kinase 1 |
Database Link | |
Background | The protein encoded by this gene is a serine/threonine kinase and is part of some signal transduction cascades, including the ERK and JNK kinase pathways as well as the NF-kappa-B pathway. The encoded protein is activated by autophosphorylation and requires magnesium as a cofactor in phosphorylating other proteins. This protein has E3 ligase activity conferred by a plant homeodomain (PHD) in its N-terminus and phospho-kinase activity conferred by a kinase domain in its C-terminus. [provided by RefSeq, Mar 2012] |
Synonyms | MAPKKK1; MEKK; MEKK 1; MEKK1; SRXY6 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Guinea pig: 100% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | GnRH signaling pathway, MAPK signaling pathway, Neurotrophin signaling pathway, RIG-I-like receptor signaling pathway, Ubiquitin mediated proteolysis |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
The MEKK1 PHD ubiquitinates TAB1 to activate MAPKs in response to cytokines
,null,
The EMBO Journal
,PubMed ID 25260751
[MAP3K1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |