PAPSS2 Rabbit Polyclonal Antibody
CAT#: TA346730
Rabbit Polyclonal Anti-PAPSS2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PAPSS2 antibody: synthetic peptide directed towards the C terminal of human PAPSS2. Synthetic peptide located within the following region: PARHNEFDFISGTRMRKLAREGENPPDGFMAPKAWKVLTDYYRSLEKN |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 70 kDa |
Gene Name | 3'-phosphoadenosine 5'-phosphosulfate synthase 2 |
Database Link | |
Background | Sulfation is a common modification of endogenous (lipids, proteins, and carbohydrates) and exogenous (xenobiotics and drugs) compounds. In mammals, the sulfate source is 3'-phosphoadenosine 5'-phosphosulfate (PAPS), created from ATP and inorganic sulfate. Two different tissue isoforms encoded by different genes synthesize PAPS. This gene encodes one of the two PAPS synthetases. Defects in this gene cause the Pakistani type of spondyloepimetaphyseal dysplasia. Two alternatively spliced transcript variants that encode different isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Synonyms | ATPSK2; BCYM4; SK2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 93% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Purine metabolism, Selenoamino acid metabolism, Sulfur metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |