PNPLA4 Rabbit Polyclonal Antibody
CAT#: TA346729
Rabbit Polyclonal Anti-PNPLA4 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PNPLA4 antibody: synthetic peptide directed towards the C terminal of human PNPLA4. Synthetic peptide located within the following region: SPFSGRLDISPQDKGQLDLYVNIAKQDIMLSLANLVRLNQALFPPSKRKM |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 28 kDa |
Gene Name | patatin like phospholipase domain containing 4 |
Database Link | |
Background | This gene encodes a member of the patatin-like family of phospholipases. The encoded enzyme has both triacylglycerol lipase and transacylase activities and may be involved in adipocyte triglyceride homeostasis. Alternate splicing results in multiple transcript variants. A pseudogene of this gene is found on chromosome Y. [provided by RefSeq, Feb 2010] |
Synonyms | DXS1283E; GS2; iPLA2eta |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rat: 86%; Guinea pig: 86% |
Reference Data | |
Protein Pathways | Retinol metabolism |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |