SULT2B1 Rabbit Polyclonal Antibody

CAT#: TA346727

Rabbit Polyclonal Anti-SULT2B1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human sulfotransferase family, cytosolic, 2B, member 1 (SULT2B1), transcript variant 2, 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-SULT2B1 antibody: synthetic peptide directed towards the C terminal of human SULT2B1. Synthetic peptide located within the following region: NTMSNYTLLPPSLLDHRRGAFLRKGVCGDWKNHFTVAQSEAFDRAYRKQM
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 41 kDa
Gene Name sulfotransferase family 2B member 1
Background Sulfotransferase enzymes catalyze the sulfate conjugation of many hormones, neurotransmitters, drugs, and xenobiotic compounds. These cytosolic enzymes are different in their tissue distributions and substrate specificities. The gene structure (number and length of exons) is similar among family members. This gene sulfates dehydroepiandrosterone but not 4-nitrophenol, a typical substrate for the phenol and estrogen sulfotransferase subfamilies. Two alternatively spliced variants that encode different isoforms have been described. [provided by RefSeq, Jul 2008]
Synonyms HSST2
Note Immunogen Sequence Homology: Human: 100%; Dog: 93%; Bovine: 92%; Rat: 86%; Rabbit: 86%; Pig: 83%; Guinea pig: 83%; Mouse: 79%
Reference Data
Protein Pathways Androgen and estrogen metabolism, Sulfur metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...