ACCSL Rabbit Polyclonal Antibody
CAT#: TA346692
Rabbit Polyclonal Anti-ACCSL Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ACCSL antibody: synthetic peptide directed towards the N terminal of human LOC390110. Synthetic peptide located within the following region: MSHRSDTLPVPSGQRRGRVPRDHSIYTQLLEITLHLQQAMTEHFVQLTSR |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 65 kDa |
Gene Name | 1-aminocyclopropane-1-carboxylate synthase (inactive)-like |
Database Link | |
Background | The exact function of LOC390110 remains unknown. |
Synonyms | 1-aminocyclopropane-1-carboxylate synthase homolog (Arabidopsis)(non-functional)-like |
Note | Immunogen Sequence Homology: Human: 100% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |