NUDT17 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-NUDT17 antibody: synthetic peptide directed towards the middle region of human NUDT17. Synthetic peptide located within the following region: YPPRLSWGLPKYHHIVLYLLVISQESQQQLQARIQPNPNEVSALMWLTPD
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	36 kDa
Gene Name	nudix hydrolase 17
Database Link	NP_001012776 Entrez Gene 200035 Human UniProt ID P0C025
Background	Probably mediates the hydrolysis of some nucleoside diphosphate derivatives.
Synonyms	FLJ34433
Note	Immunogen Sequence Homology: Human: 100%; Dog: 93%; Pig: 93%; Horse: 93%; Rat: 86%; Mouse: 86%; Bovine: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.