Epithelial Stromal Interaction 1 (EPSTI1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-EPSTI1 antibody: synthetic peptide directed towards the N terminal of human EPSTI1. Synthetic peptide located within the following region: RRLGGSQSETEVRQKQQLQLMQSKYKQKLKREESVRIKKEAEEAELQKMK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	epithelial stromal interaction 1 (breast)
Database Link	NP_001002264 Entrez Gene 94240 Human UniProt ID Q96J88
Background	EPSTI1 was up-regulated in breast carcinomas. The exact function of EPSTI1 is not known.
Synonyms	BRESI1
Note	Immunogen Sequence Homology: Human: 100%; Rat: 93%; Horse: 93%; Mouse: 93%; Dog: 86%; Bovine: 86%; Rabbit: 86%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.