Ankrd13c Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-Ankrd13c antibody is: synthetic peptide directed towards the C-terminal region of Mouse Ankrd13c. Synthetic peptide located within the following region: EQSFEPVRRQSLTPPPQNTITWEEYISAENGKAPHLGRELVCKESKKTFK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	60 kDa
Gene Name	ankyrin repeat domain 13c
Database Link	NP_001013828 Entrez Gene 433667 Mouse UniProt ID Q3UX43
Background	Acts as a molecular chaperone for G protein-coupled receptors, regulating their biogenesis and exit from the ER.
Synonyms	dJ677H15.3; DKFZP566D1346; FLJ14998; RP4-677H15.5
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 86%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.