TRUB2 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-TRUB2 antibody: synthetic peptide directed towards the N terminal of human TRUB2. Synthetic peptide located within the following region: MGSAGLSRLHGLFAVYKPPGLKWKHLRDTVELQLLKGLNARKPPAPKQRV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	TruB pseudouridine synthase family member 2
Database Link	NP_056494 Entrez Gene 26995 Human UniProt ID O95900
Background	Pseudouridine is an abundant component of rRNAs and tRNAs and is enzymatically generated by isomerization of uridine by pseudouridine synthase (Zucchini et al., 2003 [PubMed 12736709]). [supplied by OMIM, Mar 2008]. ##Evidence-Data-START## Transcript exon combination :: AK001956.1, AF131848.1 [ECO:0000332] RNAseq introns :: mixed/partial sample support ERS025081, ERS025082 [ECO:0000350] ##Evidence-Data-END##
Synonyms	CLONE24922
Note	Immunogen Sequence Homology: Rat: 100%; Human: 100%; Bovine: 93%; Pig: 86%; Horse: 86%; Guinea pig: 86%; Mouse: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.