Rab11 (RAB11B) Rabbit Polyclonal Antibody
CAT#: TA346586
Rabbit Polyclonal Anti-RAB11B Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
Cited in 1 publication. |
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-RAB11B antibody: synthetic peptide directed towards the C terminal of human RAB11B. Synthetic peptide located within the following region: IETSALDSTNVEEAFKNILTEIYRIVSQKQIADRAAHDESPGNNVVDISV |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 24 kDa |
Gene Name | RAB11B, member RAS oncogene family |
Database Link | |
Background | The Ras superfamily of small GTP-binding proteins, which includes the Ras (see MIM 190020), Ral (see MIM 179550), Rho (see MIM 165390), Rap (see MIM 179520), and Rab (see MIM 179508) families, is involved in controlling a diverse set of essential cellular functions. The Rab family, including RAB11B, appears to play a critical role in regulating exocytotic and endocytotic pathways (summary by Zhu et al., 1994 [PubMed 7811277]). [supplied by OMIM, Nov 2010]. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Gene record to access additional publications. ##Evidence-Data-START## Transcript exon combination :: AL528246.3, AL535327.3 [ECO:0000332] RNAseq introns :: single sample supports all introns ERS025081, ERS025082 [ECO:0000348] ##Evidence-Data-END## |
Synonyms | H-YPT3 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Goat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Zebrafish: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Endocytosis |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
PPFIA1 drives active a5ß1 integrin recycling and controls fibronectin fibrillogenesis and vascular morphogenesis
,Mana, G;Clapero, F;Panieri, E;Panero, V;Böttcher, RT;Tseng, H;Saltarin, F;Astanina, E;Wolanska, KI;Morgan, MR;Humphries, MJ;Santoro, MM;Serini, G;Valdembri, D;,
Nature Communications
,PubMed ID 27876801
[RAB11B]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |