STK16 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-STK16 antibody: synthetic peptide directed towards the middle region of human STK16. Synthetic peptide located within the following region: TDVWSLGCVLYAMMFGEGPYDMVFQKGDSVALAVQNQLSIPQSPRHSSAL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	serine/threonine kinase 16
Database Link	NP_003682 Entrez Gene 8576 Human UniProt ID O75716
Background	STK16 is a protein kinase that acts on both serine and threonine residues.
Synonyms	FLJ39635; KRCT; MPSK; PKL12; protein kinase expressed in day 12 fetal liver; serine; threonine kinase 16; TSF1
Note	Immunogen Sequence Homology: Dog: 100%; Goat: 100%; Human: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Bovine: 93%; Horse: 92%; Guinea pig: 86%
Reference Data
Protein Families	Druggable Genome, Protein Kinase

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.