Prostaglandin D Synthase (PTGDS) Rabbit Polyclonal Antibody

CAT#: TA346541

Rabbit Polyclonal Anti-PTGDS Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of prostaglandin D2 synthase 21kDa (brain) (PTGDS)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human prostaglandin D2 synthase 21kDa (brain) (PTGDS), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human prostaglandin D2 synthase 21kDa (brain) (PTGDS), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-PTGDS antibody: synthetic peptide directed towards the N terminal of human PTGDS. Synthetic peptide located within the following region: MATHHTLWMGLALLGVLGDLQAAPEAQVSVQPNFQQDKFLGRWFSAGLAS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 21 kDa
Gene Name prostaglandin D2 synthase
Background The protein encoded by this gene is a glutathione-independent prostaglandin D synthase that catalyzes the conversion of prostaglandin H2 (PGH2) to postaglandin D2 (PGD2). PGD2 functions as a neuromodulator as well as a trophic factor in the central nervous system. PGD2 is also involved in smooth muscle contraction/relaxation and is a potent inhibitor of platelet aggregation. This gene is preferentially expressed in brain. Studies with transgenic mice overexpressing this gene suggest that this gene may be also involved in the regulation of non-rapid eye movement sleep. [provided by RefSeq, Jul 2008]
Synonyms L-PGDS; LPGDS; PDS; PGD2; PGDS; PGDS2
Note Immunogen Sequence Homology: Rat: 100%; Human: 100%; Mouse: 100%; Dog: 86%; Rabbit: 80%; Pig: 79%; Horse: 79%; Guinea pig: 79%
Reference Data
Protein Pathways Arachidonic acid metabolism, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...