TNNI3K Rabbit Polyclonal Antibody
CAT#: TA346506
Rabbit Polyclonal Anti-TNNI3K Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 4840.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-TNNI3K antibody: synthetic peptide directed towards the middle region of human TNNI3K. Synthetic peptide located within the following region: PGRSHVAALRSRFELEYALNARSYAALSQSAGQYSSQGLSLEEMKRSLQY |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 93 kDa |
Gene Name | TNNI3 interacting kinase |
Database Link | |
Background | This gene encodes a protein that belongs to the MAP kinase kinase kinase (MAPKKK) family of protein kinases. The protein contains ankyrin repeat, protein kinase and serine-rich domains and is thought to play a role in cardiac physiology. [provided by RefSeq, Sep 2012] |
Synonyms | CARK; CCDD |
Note | Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 93%; Dog: 92% |
Reference Data | |
Protein Families | Druggable Genome, Protein Kinase |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |