Beta Arrestin 2 (ARRB2) Rabbit Polyclonal Antibody
CAT#: TA346492
Rabbit Polyclonal Anti-ARRB2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4628.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human, Mouse |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ARRB2 antibody: synthetic peptide directed towards the middle region of human ARRB2. Synthetic peptide located within the following region: RLVIRKVQFAPEKPGPQPSAETTRHFLMSDRSLHLEASLDKELYYHGEPL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 46 kDa |
Gene Name | arrestin beta 2 |
Database Link | |
Background | Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2012] |
Synonyms | ARB2; ARR2; BARR2 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Chemokine signaling pathway, Endocytosis, MAPK signaling pathway, Olfactory transduction |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它Beta Arrestin 2产品