Pregnancy Specific Glycoprotein 1 (PSG1) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PSG1 antibody: synthetic peptide directed towards the C terminal of human PSG1. Synthetic peptide located within the following region: YLSCSADSNPPAQYSWTINEKFQLPGQKLFIRHITTKHSGLYVCSVRNSA
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Protein A Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	pregnancy specific beta-1-glycoprotein 1
Database Link	NP_008836 Entrez Gene 5669 Human UniProt ID P11464
Background	The function remains unknown.
Synonyms	2; B1G1; CD66f; D; DHFRP2; FL-NCA-1; PBG1; PS-beta-C; PS-beta-G-1; PSBG-1; PSBG1; PSG95; PSGGA
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.