PRSS16 Rabbit Polyclonal Antibody
CAT#: TA346422
Rabbit Polyclonal Anti-PRSS16 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-PRSS16 antibody: synthetic peptide directed towards the middle region of human PRSS16. Synthetic peptide located within the following region: SHSTPYCGLRRAVQIVLHSLGQKCLSFSRAETVAQLRSTEPQLSGVGDRQ |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 55 kDa |
Gene Name | protease, serine 16 |
Database Link | |
Background | This gene encodes a serine protease expressed exclusively in the thymus. It is thought to play a role in the alternative antigen presenting pathway used by cortical thymic epithelial cells during the positive selection of T cells. The gene is found in the |
Synonyms | TSSP |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Human: 100%; Mouse: 100%; Rat: 93%; Rabbit: 93%; Horse: 92%; Bovine: 86%; Guinea pig: 85% |
Reference Data | |
Protein Families | Druggable Genome, Protease, Transmembrane |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |