Visfatin (NAMPT) Rabbit Polyclonal Antibody
CAT#: TA346417
Rabbit Polyclonal Anti-PBEF1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4537.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | IHC, WB |
| Recommend Dilution | WB, IHC |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-PBEF1 antibody: synthetic peptide directed towards the C terminal of human PBEF1. Synthetic peptide located within the following region: VTLEEGKGDLEEYGQDLLHTVFKNGKVTKSYSFDEIRKNAQLNIELEAAH |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Protein A Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 54 kDa |
| Gene Name | nicotinamide phosphoribosyltransferase |
| Database Link | |
| Background | PBEF1 catalyzes the condensation of nicotinamide with 5-phosphoribosyl-1-pyrophosphate to yield nicotinamide mononucleotide, one step in the biosynthesis of nicotinamide adenine dinucleotide. The protein is an adipokine that is localized to the bloodstream and has various functions, including the promotion of vascular smooth muscle cell maturation and inhibition of neutrophil apoptosis. It also activates insulin receptor and has insulin-mimetic effects, lowering blood glucose and improving insulin sensitivity. The protein is highly expressed in visceral fat and serum levels of the protein correlate with obesity. |
| Synonyms | 1110035O14Rik; PBEF; PBEF1; VF; VISFATIN |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Rabbit: 93%; Zebrafish: 93% |
| Reference Data | |
| Protein Families | Druggable Genome |
| Protein Pathways | Nicotinate and nicotinamide metabolism |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
其它Visfatin产品
