Fibrinogen beta chain (FGB) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for Anti-FGB antibody is: synthetic peptide directed towards the middle region of Human FGB. Synthetic peptide located within the following region: GNDKISQLTRMGPTELLIEMEDWKGDKVKAHYGGFTVQNEANKYQISVNK
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	fibrinogen beta chain
Database Link	NP_001171670 Entrez Gene 2244 Human UniProt ID P02675
Background	The function of this protein remains unknown.
Synonyms	HEL-S-78p
Note	Immunogen Sequence Homology: Pig: 100%; Human: 100%; Mouse: 100%; Guinea pig: 100%; Rat: 93%; Rabbit: 93%; Bovine: 91%; Dog: 86%
Reference Data
Protein Families	Druggable Genome, Secreted Protein
Protein Pathways	Complement and coagulation cascades

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.