GFPT2 Rabbit Polyclonal Antibody
CAT#: TA346395
Rabbit Polyclonal Anti-GFPT2 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 9998.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-GFPT2 antibody: synthetic peptide directed towards the middle region of human GFPT2. Synthetic peptide located within the following region: TARQGRPIILCSKDDTESSKFAYKTIELPHTVDCLQGILSVIPLQLLSFH |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 77 kDa |
| Gene Name | glutamine-fructose-6-phosphate transaminase 2 |
| Database Link | |
| Background | GFPT2 controls the flux of glucose into the hexosamine pathway. GFPT2 is most likely involved in regulating the availability of precursors for N- and O-linked glycosylation of proteins. |
| Synonyms | GFAT2 |
| Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Guinea pig: 100%; Dog: 93%; Rabbit: 93% |
| Reference Data | |
| Protein Families | Protease |
| Protein Pathways | Alanine, aspartate and glutamate metabolism, Amino sugar and nucleotide sugar metabolism, Metabolic pathways |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
