ATP2A1 Rabbit Polyclonal Antibody
CAT#: TA346377
Rabbit Polyclonal Anti-ATP2A1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 4840.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | IHC, WB |
Reactivity | Human, Rhesus macaque |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-ATP2A1 antibody: synthetic peptide directed towards the N terminal of human ATP2A1. Synthetic peptide located within the following region: MEAAHAKTTEECLAYFGVSETTGLTPDQVKRNLEKYGLNELPAEEGKTLW |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 109 kDa |
Gene Name | ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 1 |
Database Link | |
Background | This gene encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. This enzyme catalyzes the hydrolysis of ATP coupled with the translocation of calcium from the cytosol to |
Synonyms | ATP2A; SERCA1 |
Note | Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 92%; Horse: 85%; Zebrafish: 85% |
Reference Data | |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Alzheimer's disease, Calcium signaling pathway |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |