DNAJC25-GNG10 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-DNAJC25-GNG10 antibody: synthetic peptide directed towards the N terminal of human LOC552891. Synthetic peptide located within the following region: AGALVEGLYCGTRDCYEVLGVSRSAGKAEIARAYRQLARRYHPDRYRPQP
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	16 kDa
Gene Name	DNAJC25-GNG10 readthrough
Database Link	NP_004116 Entrez Gene 552891 Human UniProt ID Q9H1X3
Background	The function of the LOC552891 protein remains unknown.
Synonyms	bA16L21.2.1; DnaJ (Hsp40) homolog; DnaJ-like protein; member 25; OTTHUMP00000081796; subfamily C
Note	Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Human: 100%; Guinea pig: 100%; Dog: 93%; Mouse: 93%; Rabbit: 93%; Bovine: 86%
Reference Data
Protein Families	Druggable Genome

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.