MTMR1 Rabbit Polyclonal Antibody

CAT#: TA346366

Rabbit Polyclonal Anti-MTMR1 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of myotubularin related protein 1 (MTMR1)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human myotubularin related protein 1 (MTMR1), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human myotubularin related protein 1 (MTMR1), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MTMR1 antibody: synthetic peptide directed towards the C terminal of human MTMR1. Synthetic peptide located within the following region: KEDVYTKTISLWSYINSQLDEFSNPFFVNYENHVLYPVASLSHLELWVNY
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 73 kDa
Gene Name myotubularin related protein 1
Background MTMR1 is a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases.This gene encodes a member of the myotubularin related family of proteins. Members of this family contain the consensus sequence for the active site of protein tyrosine phosphatases. Alternatively spliced variants have been described but their biological validity has not been determined.
Synonyms myotubularin-related protein 1; myotubularin related protein 1; OTTHUMP00000025864
Note Immunogen Sequence Homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%
Reference Data
Protein Families Druggable Genome, Phosphatase
Protein Pathways Fructose and mannose metabolism, Metabolic pathways, Riboflavin metabolism, Thiamine metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...