C9orf127 (TMEM8B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-C9orf127 antibody: synthetic peptide directed towards the N terminal of human C9orf127. Synthetic peptide located within the following region: MNMPQSLGNQPLPPEPPSLGTPAEGPGTTSPPEHCWPVRPTLRNELDTFS
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	37 kDa
Gene Name	transmembrane protein 8B
Database Link	NP_057530 Entrez Gene 51754 Human UniProt ID A6NDV4
Background	The down-regulation of C9orf127 may be closely associated with tumorigenesis and metastasis of colorectal carcinoma. However, it may not contribute to the development and progression of gastric carcinoma.
Synonyms	C9orf127; NAG-5; NAG5; NGX6
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Guinea pig: 100%; Mouse: 93%; Rabbit: 93%
Reference Data
Protein Families	Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.