PSG6 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PSG6 antibody: synthetic peptide directed towards the N terminal of human PSG6. Synthetic peptide located within the following region: VLLLVHNLPQNLTGYIWYKGQMTDLYHYITSYVVHGQIIYGPAYSGRETV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	47 kDa
Gene Name	pregnancy specific beta-1-glycoprotein 6
Database Link	NP_001027020 Entrez Gene 5675 Human UniProt ID Q00889
Background	PSG6 may have a role in modulation of the innate immune system.
Synonyms	PSBG-6; PSBG-10; PSBG-12; PSG10; PSGGB
Note	Immunogen Sequence Homology: Human: 100%; Pig: 90%; Rat: 90%; Mouse: 90%; Guinea pig: 90%; Horse: 79%
Reference Data
Protein Families	Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.