LSS Rabbit Polyclonal Antibody
CNY 5250.00
CNY 300.00
CNY 1430.00
CNY 2900.00
CNY 6650.00
CNY 4840.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-LSS antibody: synthetic peptide directed towards the middle region of human LSS. Synthetic peptide located within the following region: KCPHVTEHIPRERLCDAVAVLLNMRNPDGGFATYETKRGGHLLELLNPSE |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 83 kDa |
Gene Name | lanosterol synthase (2,3-oxidosqualene-lanosterol cyclase) |
Database Link | |
Background | LSS catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. It is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Two transcript variants encoding the same protein have been found for this gene.The protein encoded by this gene catalyzes the conversion of (S)-2,3 oxidosqualene to lanosterol. The encoded protein is a member of the terpene cyclase/mutase family and catalyzes the first step in the biosynthesis of cholesterol, steroid hormones, and vitamin D. Two transcript variants encoding the same protein have been found for this gene. |
Synonyms | OSC |
Note | Immunogen Sequence Homology: Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Zebrafish: 100%; Pig: 93%; Rat: 93%; Guinea pig: 93%; Dog: 86%; Mouse: 86% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways, Steroid biosynthesis |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |