C8 (C8G) Rabbit Polyclonal Antibody
CNY 5250.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-C8G antibody is: synthetic peptide directed towards the N-terminal region of Human C8G. Synthetic peptide located within the following region: VGSACRFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGD |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Affinity Purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 22 kDa |
Gene Name | complement component 8, gamma polypeptide |
Database Link | |
Background | The protein encoded by this gene belongs to the lipocalin family. It is one of the three subunits that constitutes complement component 8 (C8), which is composed of a disulfide-linked C8 alpha-gamma heterodimer and a non-covalently associated C8 beta chain. C8 participates in the formation of the membrane attack complex (MAC) on bacterial cell membranes. While subunits alpha and beta play a role in complement-mediated bacterial killing, the gamma subunit is not required for the bactericidal activity. |
Synonyms | C8C |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Bovine: 93%; Guinea pig: 85% |
Reference Data | |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Complement and coagulation cascades, Prion diseases, Systemic lupus erythematosus |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |