FANCA Rabbit Polyclonal Antibody
CAT#: TA346159
Rabbit Polyclonal Anti-FANCA Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5200.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
| Product Data | |
| Applications | WB |
| Recommend Dilution | WB |
| Reactivity | Human |
| Host | Rabbit |
| Clonality | Polyclonal |
| Immunogen | The immunogen for anti-FANCA antibody: synthetic peptide directed towards the N terminal of human FANCA. Synthetic peptide located within the following region: KLSLSKVIDCDSSEAYANHSSSFIGSALQDQASRLGVPVGILSAGMVASS |
| Isotype | IgG |
| Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
| Purification | Affinity Purified |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Predicted Protein Size | 33 kDa |
| Gene Name | Fanconi anemia complementation group A |
| Database Link | |
| Background | The Fanconi anemia complementation group (FANC) currently includes FANCA, FANCB, FANCC, FANCD1 (also called BRCA2), FANCD2, FANCE, FANCF, FANCG, FANCI, FANCJ (also called BRIP1), FANCL, FANCM and FANCN (also called PALB2). The previously defined group FANCH is the same as FANCA. Fanconi anemia is a genetically heterogeneous recessive disorder characterized by cytogenetic instability, hypersensitivity to DNA crosslinking agents, increased chromosomal breakage, and defective DNA repair. The members of the Fanconi anemia complementation group do not share sequence similarity; they are related by their assembly into a common nuclear protein complex. This gene encodes the protein for complementation group A. Alternative splicing results in multiple transcript variants encoding different isoforms. Mutations in this gene are the most common cause of Fanconi anemia. [provided by RefSeq, Jul 2008] |
| Synonyms | FA; FA-H; FA1; FAA; FACA; FAH; FANCH |
| Note | Immunogen Sequence Homology: Pig: 100%; Human: 100%; Dog: 92%; Rat: 92%; Mouse: 92%; Bovine: 83%; Guinea pig: 79% |
| Reference Data | |
| Protein Families | Druggable Genome |
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
