ARSL Rabbit Polyclonal Antibody

CAT#: TA346152

Rabbit Polyclonal Anti-ARSE Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
Transient overexpression lysate of arylsulfatase E (chondrodysplasia punctata 1) (ARSE)
    • 100 ug

CNY 4840.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human arylsulfatase E (chondrodysplasia punctata 1) (ARSE), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human arylsulfatase E (chondrodysplasia punctata 1) (ARSE), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-ARSE antibody: synthetic peptide directed towards the middle region of human ARSE. Synthetic peptide located within the following region: KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTLS
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 62 kDa
Gene Name arylsulfatase E (chondrodysplasia punctata 1)
Background Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene.Arylsulfatase E is a member of the sulfatase family. It is glycosylated postranslationally and localized to the golgi apparatus. Sulfatases are essential for the correct composition of bone and cartilage matrix. X-linked chondrodysplasia punctata, a disease characterized by abnormalities in cartilage and bone development, has been linked to mutations in this gene. PRIMARYREFSEQ_SPAN PRIMARY_IDENTIFIER PRIMARY_SPAN COMP 1-170 AC005295.1 87561-87730 c 171-744 AK223183.1 1-574 745-2036 AK223199.1 542-1833 2037-2220 AW779826.1 1-184 c
Synonyms ASE; CDPX; CDPX1; CDPXR
Note Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families Druggable Genome, Transmembrane
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...