CXCL16 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CXCL16 antibody: synthetic peptide directed towards the C terminal of human CXCL16. Synthetic peptide located within the following region: TARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPDLPVHYIPV
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	29 kDa
Gene Name	C-X-C motif chemokine ligand 16
Database Link	NP_071342 Entrez Gene 58191 Human UniProt ID Q9H2A7
Background	CXCL16 acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis. It induces a strong chemotactic response and calcium mobilization.
Synonyms	CXCLG16; SR-PSOX; SRPSOX
Note	Immunogen Sequence Homology: Human: 100%
Reference Data
Protein Families	Druggable Genome, Secreted Protein, Transmembrane
Protein Pathways	Chemokine signaling pathway, Cytokine-cytokine receptor interaction

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.