ketohexokinase (KHK) Rabbit Polyclonal Antibody

CAT#: TA346115

Rabbit Polyclonal Anti-KHK Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4628.00


货期*
2周

规格
    • 50 ug

Product images

推荐一起购买 (5)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human ketohexokinase (fructokinase) (KHK), transcript variant b, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of ketohexokinase (fructokinase) (KHK), transcript variant a
    • 100 ug

CNY 3080.00


Recombinant protein of human ketohexokinase (fructokinase) (KHK), transcript variant b, 100 µg
    • 100 ug

CNY 9998.00


Transient overexpression lysate of ketohexokinase (fructokinase) (KHK), transcript variant b
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-KHK antibody: synthetic peptide directed towards the N terminal of human KHK. Synthetic peptide located within the following region: FLVADFRRRGVDVSQVAWQSKGDTPSSCCIINNSNGNRTIVLHDTSLPDV
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 32 kDa
Gene Name ketohexokinase
Background KHK is a ketohexokinase that catalyzes conversion of fructose to fructose-1-phosphate. The product of this gene is the first enzyme with a specialized pathway that catabolizes dietary fructose.
Synonyms ketohexokinase; ketohexokinase (fructokinase)
Note Immunogen Sequence Homology: Human: 100%; Dog: 79%; Pig: 79%; Bovine: 79%; Guinea pig: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Fructose and mannose metabolism, Metabolic pathways
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...