Myoglobin (MB) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-MB antibody: synthetic peptide directed towards the N terminal of human MB. Synthetic peptide located within the following region: MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	17 kDa
Gene Name	myoglobin
Database Link	NP_005359 Entrez Gene 4151 Human UniProt ID P02144
Background	This gene encodes a member of the globin superfamily and is expressed in skeletal and cardiac muscles. The encoded protein is a haemoprotein contributing to intracellular oxygen storage and transcellular facilitated diffusion of oxygen.
Synonyms	myoglobgin; PVALB
Note	Immunogen Sequence Homology: Human: 100%; Horse: 93%; Pig: 86%; Goat: 86%; Sheep: 86%; Bovine: 86%; Rabbit: 86%; Mouse: 85%; Dog: 79%; Rat: 79%; Guinea pig: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.