FCN3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-FCN3 antibody: synthetic peptide directed towards the N terminal of human FCN3. Synthetic peptide located within the following region: LEASKVVLLPSCPGAPGSPGEKGAPGPQGPPGPPGKMGPKGEPGDPVNLL
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	31 kDa
Gene Name	ficolin 3
Database Link	NP_003656 Entrez Gene 8547 Human UniProt ID O75636
Background	Ficolins are a group of proteins which consist of a collagen-like domain and a fibrinogen-like domain. In human serum, there are two types of ficolins, both of which have lectin activity.
Synonyms	FCNH; HAKA1
Note	Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Zebrafish: 92%; Pig: 91%; Mouse: 91%; Bovine: 91%; Dog: 79%; Rabbit: 79%; Guinea pig: 77%
Reference Data
Protein Families	Druggable Genome, Secreted Protein

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.