MAT1A Rabbit Polyclonal Antibody

CAT#: TA346037

Rabbit Polyclonal Anti-MAT1A Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 4537.00


货期*
2周

规格
    • 100 ug

Product images

推荐一起购买 (4)
Transient overexpression lysate of methionine adenosyltransferase I, alpha (MAT1A)
    • 100 ug

CNY 3080.00


beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human methionine adenosyltransferase I, alpha (MAT1A), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human methionine adenosyltransferase I, alpha (MAT1A), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications WB
Recommend Dilution WB
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-MAT1A antibody: synthetic peptide directed towards the C terminal of human MAT1A. Synthetic peptide located within the following region: VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.
Purification Affinity Purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 44 kDa
Gene Name methionine adenosyltransferase 1A
Background MAT1A catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. MAT1A is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in its gene are associated with methionine adenosyltransferase deficiency.This gne encodes methionine adenosyltransferase I (alpha isoform), which catalyzes the formation of S-adenosylmethionine from methionine and ATP. Methionine adenosyltransferase deficiency is caused by recessive and dominant mutations, the latter identified in autosomal dominant persistant hypermethioninemia.
Synonyms MAT; MATA1; SAMS; SAMS1
Note Immunogen Sequence Homology: Dog: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Guinea pig: 93%; Rabbit: 86%; Zebrafish: 79%
Reference Data
Protein Families Druggable Genome
Protein Pathways Cysteine and methionine metabolism, Metabolic pathways, Selenoamino acid metabolism
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...