ELAC1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-ELAC1 antibody: synthetic peptide directed towards the middle region of human ELAC1. Synthetic peptide located within the following region: LFHRIPSFGFSVVEKKRPGKLNAQKLKDLGVPPGPAYGKLKNGISVVLEN
Isotype	IgG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	40 kDa
Gene Name	elaC ribonuclease Z 1
Database Link	NP_061166 Entrez Gene 55520 Human UniProt ID Q9H777
Background	ELAC1 belongs to the RNase Z family. It is a zinc phosphodiesterase, which displays some tRNA 3'-processing endonuclease activity. The protein is probably involved in tRNA maturation, by removing a 3'-trailer from precursor tRNA.
Synonyms	D29
Note	Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.