U1SNRNPBP (SNRNP35) Rabbit Polyclonal Antibody
CAT#: TA345994
Rabbit Polyclonal Anti-U1SNRNPBP Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5250.00
CNY 2900.00
CNY 6650.00
CNY 3080.00
CNY 3080.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-U1SNRNPBP antibody: synthetic peptide directed towards the N terminal of human U1SNRNPBP. Synthetic peptide located within the following region: RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 28 kDa |
Gene Name | small nuclear ribonucleoprotein U11/U12 subunit 35 |
Database Link | |
Background | U1SNRNPBP is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors.The protein encoded by this gene is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors. This gene is differentially expressed in a variety of human tissues. Multiple alternatively spliced transcript variants have been found for this gene, and they differ in the 5' sequence regions. |
Synonyms | HM-1; MGC138160; small nuclear ribonucleoprotein 35kDa (U11; U1 snRNP binding protein homolog; U1-snRNP binding protein homolog; U1SNRNPBP; U11; U12 snRNP 35K; U12) |
Note | Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |
其它U1SNRNPBP产品