U1SNRNPBP (SNRNP35) Rabbit Polyclonal Antibody

CAT#: TA345994

Rabbit Polyclonal Anti-U1SNRNPBP Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (4)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human small nuclear ribonucleoprotein 35kDa (U11/U12) (SNRNP35), transcript variant 3, 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Transient overexpression lysate of small nuclear ribonucleoprotein 35kDa (U11/U12) (SNRNP35), transcript variant 3
    • 100 ug

CNY 3080.00


Transient overexpression lysate of small nuclear ribonucleoprotein 35kDa (U11/U12) (SNRNP35), transcript variant 4
    • 100 ug

CNY 3080.00

Specifications

Product Data
Applications IHC, WB
Recommend Dilution WB, IHC
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-U1SNRNPBP antibody: synthetic peptide directed towards the N terminal of human U1SNRNPBP. Synthetic peptide located within the following region: RAVWRAMLARYVPNKGVIGDPLLTLFVARLNLQTKEDKLKEVFSRYGDIR
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 28 kDa
Gene Name small nuclear ribonucleoprotein U11/U12 subunit 35
Background U1SNRNPBP is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors.The protein encoded by this gene is a homolog of U1-snRNP binding protein. Its N-terminal half contains a RNA recognition motif and the C-terminal half is rich in Arg/Asp and Arg/Glu dipeptides, a characteristic of a variety of splicing factors. This gene is differentially expressed in a variety of human tissues. Multiple alternatively spliced transcript variants have been found for this gene, and they differ in the 5' sequence regions.
Synonyms HM-1; MGC138160; small nuclear ribonucleoprotein 35kDa (U11; U1 snRNP binding protein homolog; U1-snRNP binding protein homolog; U1SNRNPBP; U11; U12 snRNP 35K; U12)
Note Immunogen Sequence Homology: Human: 100%; Rabbit: 100%; Dog: 93%; Pig: 93%; Rat: 93%; Horse: 93%; Mouse: 93%; Bovine: 93%; Guinea pig: 93%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...