CPSF6 Rabbit Polyclonal Antibody

CAT#: TA345993

Rabbit Polyclonal Anti-CPSF6 Antibody



Need it in bulk or conjugated?
Get a free quote

CNY 5250.00


货期*
6周

规格
    • 100 ul

Product images

推荐一起购买 (3)
beta Actin Mouse Monoclonal Antibody, Clone OTI1, Loading Control
    • 30 ul

CNY 300.00
CNY 1430.00


Recombinant protein of human cleavage and polyadenylation specific factor 6, 68kDa (CPSF6), 20 µg
    • 20 ug

CNY 2900.00
CNY 6650.00


Recombinant protein of human cleavage and polyadenylation specific factor 6, 68kDa (CPSF6), 100 µg
    • 100 ug

CNY 9998.00

Specifications

Product Data
Applications IF, IHC, WB
Recommend Dilution WB, IHC, IF
Reactivity Human
Host Rabbit
Clonality Polyclonal
Immunogen The immunogen for anti-CPSF6 antibody: synthetic peptide directed towards the middle region of human CPSF6. Synthetic peptide located within the following region: PPLAGPPNRGDRPPPPVLFPGQPFGQPPLGPLPPGPPPPVPGYGPPPGPP
Isotype IgG
Formulation Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Purification Protein A purified
Conjugation Unconjugated
Storage Condition Store at -20°C as received.
Predicted Protein Size 61 kDa
Gene Name cleavage and polyadenylation specific factor 6
Background CPSF6 is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides.The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitement of other processing factors. The cleavage factor complex is composed of four polypeptides. This gene encodes the 68kD subunit. It has a domain organization reminiscent of spliceosomal proteins.
Synonyms CFIM; CFIM68; HPBRII-4; HPBRII-7
Note Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Zebrafish: 79%
Reference Data
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.
Customer Reviews 
Loading...