POP4 Rabbit Polyclonal Antibody
CNY 4537.00
CNY 3080.00
CNY 300.00
CNY 1430.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-POP4 antibody: synthetic peptide directed towards the C terminal of human POP4. Synthetic peptide located within the following region: EDRLKVIPKLNCVFTVETDGFISYIYGSKFQLRSSERSAKKFKAKGTIDL |
Isotype | IgG |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Purification | Protein A purified |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 24 kDa |
Gene Name | POP4 homolog, ribonuclease P/MRP subunit |
Database Link | |
Background | POP4 is a part of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. It may function with RPP38 to coordinate the nucleolar targeting and/or assembly of RNase P. |
Synonyms | RPP29 |
Note | Immunogen Sequence Homology: Dog: 100%; Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Mouse: 93%; Zebrafish: 92%; Yeast: 91% |
Reference Data |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |